PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG001039t1
Common NameTCM_001039
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 331aa    MW: 37144.8 Da    PI: 4.6969
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG001039t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.9e-1957110356
                       --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       k+++++ +q+++Le+ Fe ++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  Thecc1EG001039t1  57 KKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWK 110
                       566899***********************************************9 PP

2HD-ZIP_I/II128.72.5e-4156148193
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                       ekkrrls +qvk+LE++Fe e+kLeperKv+la+eLglqprqvavWFqnrRAR+ktkqlE+dy  Lk++y++lk + ++L++++e+L +e++e
  Thecc1EG001039t1  56 EKKRRLSVDQVKALEKNFEVENKLEPERKVKLAQELGLQPRQVAVWFQNRRARWKTKQLERDYGLLKTSYETLKVNYDTLQHDNEALLKEIRE 148
                       69*************************************************************************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-1943114IPR009057Homeodomain-like
PROSITE profilePS5007117.34652112IPR001356Homeobox domain
SMARTSM003891.1E-1755116IPR001356Homeobox domain
CDDcd000869.98E-1757113No hitNo description
PfamPF000463.8E-1657110IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-1959118IPR009057Homeodomain-like
PRINTSPR000319.5E-68392IPR000047Helix-turn-helix motif
PROSITE patternPS00027087110IPR017970Homeobox, conserved site
PRINTSPR000319.5E-692108IPR000047Helix-turn-helix motif
PfamPF021834.7E-16112153IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008483Molecular Functiontransaminase activity
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MKRLGSSDSL GALMSICPTT DEHSPRNNHI YSREFQSMLD GLDEEGCVEE SGHVAEKKRR  60
LSVDQVKALE KNFEVENKLE PERKVKLAQE LGLQPRQVAV WFQNRRARWK TKQLERDYGL  120
LKTSYETLKV NYDTLQHDNE ALLKEIRELK AKLNGESTES NLSVKEEVIV HETDNKTLEQ  180
SEPPPVSSLV TSSEPAELNY ESFNNSIGSV GATLFPDLKD GSSDSDSSAI LNEDNNNCSP  240
NNAAISSSGV LQSQQHLLMS PTTTSSLNFN SSSSSPSSMN CFQFSKSTYQ PSHQYVKMEE  300
HNFFSADEAC NFFSDEQAPS LHWYSPEQWN *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1104112RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5270863e-40HQ527086.1 Gossypium herbaceum clone NBRI_D2_391 simple sequence repeat marker, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047859.10.0Pyrimidine 4 isoform 1
RefseqXP_007047858.10.0Alanine--glyoxylate aminotransferase 2 isoform 1
SwissprotQ940J16e-81ATB16_ARATH; Homeobox-leucine zipper protein ATHB-16
TrEMBLA0A061DJ940.0A0A061DJ94_THECC; Alanine--glyoxylate aminotransferase 2 isoform 1
STRINGPOPTR_0005s07290.11e-162(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54528143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.12e-74homeobox protein 16
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]